PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G14240.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 285aa    MW: 31366.5 Da    PI: 7.0553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G14240.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.46.2e-32271499128
              NAM   9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.....kg 97 
                      Pt+ +lvv+yL++++ ++++++ ++i++vdi++++Pwd+   ++++++  yfF++++++   ++r+nra+ +g+W+  g++ ++++k     ++
  OGLUM11G14240.2  27 PTNADLVVHYLHRRAIQEPVPC-DFITNVDILQHNPWDIV-PAEEKTNGKYFFIHEENERLGNHRSNRAAGDGFWRPAGSEVPIYHKrsggaDE 118
                      9*********************.99**************5.455677899************************************98877777 PP

              NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                      +lvg+k+tLvf+ g+++++++t+Wvm+e+rl
  OGLUM11G14240.2 119 ALVGMKRTLVFHYGNSSSAKRTEWVMQEFRL 149
                      77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.82319215IPR003441NAC domain
SuperFamilySSF1019415.49E-3126154IPR003441NAC domain
PfamPF023652.0E-1527149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MQEVLERRMA SPGVCINLVN GTSTRLPTNA DLVVHYLHRR AIQEPVPCDF ITNVDILQHN  60
PWDIVPAEEK TNGKYFFIHE ENERLGNHRS NRAAGDGFWR PAGSEVPIYH KRSGGADEAL  120
VGMKRTLVFH YGNSSSAKRT EWVMQEFRLA GATLIPCPVT RPATGDGSML PCHRTGTTIA  180
TENNGSPSAG QTHGPLEKTM VEPDSSLRIC RIYKKRQRTP QFIIPPSIGD ARELILALPT  240
IGNTRKVALA LPAIDFLGQP SFEEGSDVSA DVITDDKDGY GHGMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-182714923140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420100.0AK242010.1 Oryza sativa Japonica Group cDNA, clone: J075106F03, full insert sequence.
GenBankEU8470010.0EU847001.1 Oryza sativa Japonica Group clone KCS322B05 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616648.10.0PREDICTED: NAC transcription factor NAM-1
TrEMBLA0A0E0BJF10.0A0A0E0BJF1_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g31340.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-24NAC domain containing protein 50